PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30050-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 216aa    MW: 23446 Da    PI: 10.3073
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30050-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.63.6e-15117165452
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      + r+rr++kNRe+A rsR+RK+a++ eLe + ++L  eN++L+k+ +  
  TRIUR3_30050-P1 117 VDRQRRMIKNRESAARSRARKQAYTNELEMELAQLRRENQMLIKREQDF 165
                      679***************************************9986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-8114178IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415116168IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-10119168No hitNo description
PfamPF001705.0E-13119168IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-13119168No hitNo description
CDDcd147074.90E-20119163No hitNo description
PROSITE patternPS000360121136IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
METRLIPAID GFDPSDPRFS SSTTFVILSY HIRSPAAAVY PQDYLAGPVP LRRGAPYTAL  60
TLSSSVQFTF HGGGPGSGTP SGSSSCNDYP FGFPSASGAN SGNNNSKRVQ VDAPAAVDRQ  120
RRMIKNRESA ARSRARKQAY TNELEMELAQ LRRENQMLIK REQDFIKERS ATAAQAAVLP  180
DCSSSSSNGG GRSRSSRSTL HFELEQRQRC RSAPAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3758361e-159AK375836.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3107H21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM7ZAI81e-157M7ZAI8_TRIUA; Protein FD
STRINGMLOC_60135.12e-88(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP146021020
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.18e-16bZIP family protein